In addition to its antibacterial activity, the cathelicidin-derived LL-37 peptide induces multiple immunomodulatory effects on host cells. Atomic force microscopy, F-actin staining with phalloidin, passage of FITC-conjugated dextran through a monolayer of lung epithelial cells, and assessment of bacterial outgrowth from cells subjected to Pseudomonas aeruginosa infection were used to determine LL-37’s effect on epithelial cell mechanical properties, permeability, and bacteria uptake. A concentration-dependent increase in stiffness and F-actin content in the cortical region of A549 cells and primary human lung epithelial cells was observed after treatment with LL-37 (0.5–5 μM), sphingosine 1-phosphate (1 μM), or LPS (1 μg/ml) or infection with PAO1 bacteria. Other cationic peptides, such as RK-31, KR-20, or WLBU2, and the antibacterial cationic steroid CSA-13 did not reproduce the effect of LL-37. A549 cell pretreatment with WRW4, an antagonist of the transmembrane formyl peptide receptor-like 1 protein attenuated LL-37’s ability to increase cell stiffness. The LL-37–mediated increase in cell stiffness was accompanied by a decrease in permeability and P. aeruginosa uptake by a confluent monolayer of polarized normal human bronchial epithelial cells. These results suggested that the antibacterial effect of LL-37 involves an LL-37–dependent increase in cell stiffness that prevents epithelial invasion by bacteria.

Cationic antibacterial peptides (CAPs) play an important role in innate host defense, particularly by preventing bacterial infections in the eye and at mucosal surfaces that form a shield between host and the external environment. In humans, this function is typically mediated by defensins and cathelicidins, which are produced primarily by neutrophils and epithelial cells. Both of these peptide agents have the capacity to kill various microorganisms (13). The only known cathelicidin peptide expressed in humans is LL-37, a 37-aa C-terminal domain of human (h)CAP-18 (4). The importance of cathelicidins as an effective defense against pathogenic microorganisms is illustrated by the high occurrence of periodontal disease in patients with severe congenital neutropenia accompanied by a deficiency of LL-37 in saliva (5), as well as an animal study showing severe bacterial skin infections in mice lacking murine cathelicidin-related CAPs (6). Overexpression of hCAP-18 after pulmonary gene transfer in mice results in increased Pseudomonas aeruginosa clearance in the course of pulmonary challenge (7). The spectrum of LL-37 activities includes many other immunomodulatory effects, such as chemotactic activation of monocytes, neutrophils, and T cells mediated through the G protein-coupled formyl peptide receptor-like 1 (8); airway epithelial cell IL-8 production, proliferation, and wound closure mediated by the epidermal growth factor receptor (9, 10); and possibly IL-1β processing and release via direct activation of P2X7 receptors (11). The cellular mechanisms and signaling pathways involved in the multiple functions of LL-37 are of interest because they might provide new strategies for antibacterial and immunomodulatory drug development (12, 13).

P. aeruginosa is a major opportunistic pathogen causing chronic pneumonia in immunocompromised patients during prolonged hospitalization, particularly in patients who are ventilated and those who are neutropenic, and is responsible for lethal pulmonary infection in most cystic fibrosis (CF) subjects. It is generally assumed that P. aeruginosa-induced lung inflammation involves binding to airway cells and subsequent direct and indirect cytotoxic effects (14, 15). One possible result of bacteria–lung epithelial cell interaction is bacterial internalization (16), although the mechanism of entry and the role of intracellular organisms in the epithelial life cycle remain unclear (1721). It was proposed that bacterial uptake might result in desquamation of infected cells and bacteria clearance (14), intracellular survival of bacteria without killing the host cells, and host cell death through bacteria-mediated cytotoxicity (18). In contrast, the outcome of P. aeruginosa internalization might also depend on lung epithelial cell apoptosis likely induced via the CD95/CD95 ligand system (22), with involvement of the CF transmembrane conductance regulator (20). It was recently reported that apoptosis of infected epithelial cells targets P. aeruginosa into apoptotic bodies, which are subsequently internalized and digested by surrounding cells (20). This mechanism might be defective in CF, permitting P. aeruginosa internalization without epithelial cell apoptosis, resulting in intracellular bacteria survival, division, and escape from the host immune system (22). Internalization and activation of apoptosis might also depend on the growth phase of P. aeruginosa (only organisms in mid-growth phase interact with epithelial cells) (23) and the strain type (19, 24, 25). Generally, clinical isolates of P. aeruginosa exhibit both invasive and cytotoxic phenotypes. Invasion and cytotoxicity occur as independent events, but both involve host cell protein tyrosine kinase activity. Invasion requires both Src family tyrosine kinases and calcium-calmodulin activity (24, 26).

In this article, we report that LL-37 induces polymerization of cortical actin in lung epithelial cells and leads to an increase in cell stiffness and a decrease in epithelial permeability. These effects might contribute to an observed decrease in P. aeruginosa internalization.

LL-37 ([LL-37, 37 aa]), RK-31 (RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES), KR-20 (KRIVQRIKDFLRNLVPRTES), and WLBU2 (RRWVRRVRRWVRRVVRVVRRWVRR) peptides were purchased from Peptide2.0 (Chantilly, VA). FITC-dextran (average molecular mass, 4 kDa), ATP, periodate-oxidized sodium salt (ox-ATP) (A6779), P. aeruginosa LPS from serotype 10, Escherichia coli LPS serotype O26:B6, and sphingosine 1-phosphate (S1P) were purchased from Sigma-Aldrich (St. Louis, MO). Pseudomonas isolation agar (PIA), Luria–Bertani broth, and tryptic soy broth (TSB) were purchased from DIFCO (Sparks, MD). Lactate dehydrogenase (LDH) cytotoxicity assay kit was from BioVision (Mountain View, CA). Anti–hCAP-18/LL-37 Ab was from Novus Biologicals (Littleton, CO). Suramin was purchased from EMD Chemicals (Gibbstown, NJ) and WRW4 from Anaspec (San Jose, CA). Ceragenin CSA-13 was synthesized, as described previously (27). CF sputum samples were collected from patients attending the University of Pennsylvania Health System Adult Cystic Fibrosis Center at Presbyterian Hospital (Philadelphia, PA) (Institutional Review Board No. 803255).

Human lung epithelial carcinoma cells, line A549, were cultured in DMEM (BioWhittaker, Walkersville, MD) and supplemented with 10% FBS (Hyclone, Logan, UT) at 37°C with 5% CO2. Cells were seeded and allowed to spread for 24–72 h before experiments were performed. When required, A549 cells were incubated with receptor antagonist for 30 min at 37°C before LL-37 stimulation. Primary normal human bronchial epithelial cells (NHBEs; Lonza, Walkersville, MD) were plated on T-75 flasks in bronchial epithelial growth media with all supplements (bovine pituitary extract, hydrocortisone, human epidermal growth factor, epinephrine, transferrin, insulin, retinoic acid, triiodothyronine, gentamycin sulfate, amphotericin B) and allowed to grow until 90% confluent. Cells were then trypsinized and seeded at a density of ∼4 × 105/ml in differentiation media (bronchial epithelial growth media without triiodothyronine supplemented with 50 nM trans retinoic acid) on 0.4-μm-pore insert membranes coated with a 3:1 mixture of bovine collagen I and human fibronectin. After reaching confluence, differentiation medium was removed from the apical surface of the cells, and the cells were allowed to grow at an air–liquid interface until polarized epithelial cell monolayers developed, as assessed by the presence of cilia (expression of acetylated α-tubulin) and mucin production (staining with Texas Red-conjugated lectin).

To determine antibacterial peptide effects on cell stiffness, A549 and primary lung epithelial cells were rinsed with PBS and placed in serum-free and serum-containing DMEM supplemented with increasing concentrations of LL-37. Stiffness was measured before and after addition of S1P, LL-37 (with or without LPS), CSA-13, P. aeruginosa PAO1, RK-31, and KR-20 [LL-37–derived peptides with reduced ability to induce IL-8 production (28)], as well as WLBU2 (a peptide with an optimized sequence that results in increased bacteria killing). Atomic force microscopy measurements were done with a DAFM-2X Bioscope (Veeco, Woodbury, NY) mounted on an Axiovert 100 microscope (Zeiss, Thornwood, NY) using silicon nitride cantilevers (196 μm long, 23 μm wide, 0.6 μm thick) with a pyramidal tip for indentation. The spring constant of the cantilever, calibrated by resonance measurements, was typically 0.06 N/m (DNP, Veeco). To determine epithelial cell stiffness, atomic force microscopy measurements were made on single cells by indenting on three areas (∼1.6 μm2) of the periphery of the cell body ∼30 min after agonist addition. The average elastic modulus for each condition was calculated by averaging the measurements for each cell, followed by averaging all obtained values.

A549 cells after treatment with various reagents or a nontreated confluent monolayer of human lung polarized epithelial cells were washed three times with PBS and fixed in 4% paraformaldehyde (Sigma-Aldrich) for 10 min at room temperature, followed by a wash with PBS. Cells were then permeabilized with 0.2% Triton X-100 for 5 min at room temperature. To visualize F-actin, the fixed and permeabilized cells were stained with a 1:100 solution of rhodamine-labeled phalloidin (Invitrogen) in PBS for 30 min. For NHBEs, the polarized monolayer was first stained with anti-acetylated α tubulin mAb (1:100) (Abcam, Cambridge, MA). The assessment of hCAP-18/LL-37 expression in A549 cells was performed by immunostaining both nonpermeabilized and permeabilized samples (0.2% Triton X-100). A549 cells treated with exogenous LL-37 (2 μM) were used as a positive control. The presence of mucin on the surface of NHBEs was evaluated using staining with Texas Red-conjugated lectin (data not shown). Fluorescence was imaged using a LEICA DM IRBE microscope.

A549 cells were grown to confluence in six-well plates, with each experimental condition performed in duplicate wells. After 48 h, cells were treated with various concentrations of LL-37 and WLBU2 for 30 min. After two washes with ice-cold PBS, the cells were lysed by adding 300 μl/well of a 1% Triton X-100 solution containing 20 mM Tris-HCl (pH 7.5), 150 mM NaCl, 1 mM Na2EDTA, 1 mM EGTA, 2.5 mM sodium pyrophosphate, 1 mM β-glycerophosphate, 1 mM Na3VO4, 1 μg/ml leupeptin, and 0.1 mM PMSF and incubated on ice for 20 min. The cell lysates from each group were pooled and centrifuged at 14,000 rpm for 5 min, and the supernatants (600 μl) were removed. The Triton-insoluble pellets were washed with cold PBS, centrifuged again, and resuspended in 40 μl sample buffer containing 60 mM Tris (pH 8), 5% mercaptoethanol, 2% SDS, 0.0025% bromophenol blue, and 10% glycerol. All samples were boiled for 10 min, and 15 μl each sample was subjected to SDS-PAGE (10% polyacrylamide gel). Actin was identified by its molecular mass (43 kDa) by comparison with purified actin from rabbit skeletal muscle as a positive control, as well as by Western blotting using mouse anti–β-actin Ab (1:10000 TBST dilution; Sigma-Aldrich).

To obtain clinical strains of P. aeruginosa, a 10-μl aliquot of undiluted homogenized sputum (from subjects already identified as chronically infected with nonmucoid strains of P. aeruginosa) was inoculated onto a single plate of PIA. P. aeruginosa PAO1 and clinical isolates of P. aeruginosa from CF sputa were maintained in TSB with glycerol (25%) at −80°C. When required, bacteria from frozen stocks were streaked on PIA plates before the experiment. Bacteria were grown in TSB in all experiments.

P. aeruginosa grown to mid-log phase at 37°C (controlled by the evaluation of OD at 600 nm) were resuspended in DMEM. LL-37 and gentamicin activities were evaluated using a bacterial-killing assay. After 15-, 30-, 60-, 120-, and 180-min incubations of PAO1 and 180-min incubations of clinical isolates (all bacterial suspensions in DMEM), with different concentrations of antibacterial agents at 37°C, samples were placed on ice and diluted 10–1000-fold. Ten-microliter aliquots of each dilution were spotted on PIA. The number of colonies at each dilution was counted the following morning. The CFU/ml of the individual samples were determined from the dilution factor.

The gentamicin-protection assay (20, 29, 30) was used to assess P. aeruginosa internalization. Before infection, cells were incubated with medium alone or with medium containing LL-37 (0.5–2 μM) for 30 min. Bacteria from each strain were grown to mid-logarithmic phase, washed, resuspended in DMEM, and added to the apical cell surface of cells grown to 100% confluence. To evaluate whether the bacterial-killing ability of LL-37 interfered with bacterial internalization or the effect of gentamicin, LL-37 treatment was conducted in two settings. In the first, A549 cells were treated with LL-37 for 30 min, and LL-37 was washed out before the addition of bacteria. In the second, A549 cells were incubated with LL-37 for 30 min, and bacteria were added without washing out the peptide. In both settings, A549 cells were infected with 106 CFU/ml of PAO1. In addition to the invasion assay performed on A549 cells in cell culture media, we performed this assay in polarized cultures of A549 and NHBEs. Polarized cultures were incubated with LL-37 (2 μM) added to both the apical and basal sides of cells for 30 min before adding one of three clinical isolates of P. aeruginosa (107 CFU/ml) to the apical side of the culture. After addition of bacteria in all conditions, the dishes were incubated at 37°C/5% CO2 for 3 h for culture with PAO1 and 6 h for polarized cultures with clinical strains of P. aeruginosa. Nonadherent bacteria were removed from the monolayers by washing three times with 1 ml DMEM. Then a gentamicin solution in DMEM (200 μg/ml) was added, and a 120-min incubation to kill extracellular bacteria was performed. The antibiotic was removed by washing three times with 1 ml DMEM, and the monolayer containing intracellular bacteria was subjected to a Triton X-100 (0.5%; 200 μl/well) solution, followed by a 5-min incubation and subsequent addition of 800 μl TSB. Serial 10-fold dilutions of cell lysates were made, and 10-μl aliquots were plated on PIA to quantify bacteria survivors (intracellular bacteria). The number of CFU was determined after overnight incubation at 37°C. As a control, we tested whether Pseudomonas was killed in a well treated with gentamicin after cells had been lysed with Triton X-100.

Epithelial cytotoxicity associated with bacterial infection was assessed by measurements of LDH released into culture supernatants, which was compared with the total enzyme activity recovered from lung epithelial cell monolayers after cell lysis with 0.1% Triton X-100. An LDH colorimetric assay kit was used, according to the manufacturer’s instructions.

Data are reported as mean ± SD from three to six experiments. Data analysis was performed using one-way ANOVA tests, with a post hoc Bonferroni analysis test.

We recently observed an increase in cell stiffness after treating bovine aortic endothelial cells and mouse aortic endothelium with LL-37 (31). Similarly, human A549 and primary lung epithelial cells responded to LL-37 treatment with a concentration-dependent increase in their stiffness (Fig. 1). The elastic modulus of resting A549 cells was very close to that of primary lung epithelial cells (Fig. 1A, 1B). LL-37 increased A549 cell stiffness ∼30% more compared with the effects of truncated LL-37 moieties, such as RK-30 and KR-20, and ∼85% higher compared with the longer peptide WLBU2, which in several experimental conditions showed stronger bactericidal activity than LL-37 (32, 33) (Fig. 1C). S1P, a bioactive lipid involved in regulation of epithelial permeability was shown in previous studies to increase cellular stiffness (31, 34). In this study, treatment of A549 cells with S1P for 30 min at 1 μM concentration resulted in an ∼1.7-fold increase in elastic modulus (data not shown), similar to the magnitude of stiffening induced by 5 μM LL-37 (Fig. 1A). CSA-13, a membrane-active, antibacterial cationic steroid had no effect on A549 cell stiffness at concentrations up to 2 μM. Twenty minutes after addition of P. aeruginosa PAO1 bacteria (106 CFU/ml) to A549 cells, we observed a statistically significant increase in epithelial cell stiffness, similar to the effect of purified P. aeruginosa LPS at a concentration of 1 μg/ml (Fig. 1D). Stiffening of A549 cells was also observed when LL-37 was added together with PAO1 bacteria (Fig. 1D). In contrast, purified LPS (0.1–1 μg/ml) decreased LL-37’s ability (2 μM) to induce A549 cell stiffening (Fig. 1E). This finding is in agreement with several studies showing inactivation of the antibacterial function of LL-37 by LPS (3539). It is interesting to note that the elastic modulus of A549 cells treated with a premixed solution of LPS and LL-37 is significantly lower than the elastic modulus of cells treated with either agonist separately. This observation indicates a mutual inactivation of cell-stiffening capabilities of LPS and LL-37 upon their interaction.

FIGURE 1.

Increase in cell stiffness observed ∼30 min after addition of LL-37 to A549 human lung epithelial cells (A) and primary lung epithelial cells (B). C, LL-37–induced increase in A549 cell stiffness is significantly higher compared with the effects of KR-20, WLBU2, or CSA-13 but not RK-30. D, A549 cell stiffening after the addition of P. aeruginosa LPS (1 μg/ml) and P. aeruginosa PAO1 (106 CFU/ml) or P. aeruginosa PAO1 in combination with LL-37. E, Preincubation of LL-37 (2 μM) with LPS inhibits LL-37–induced increase in A549 cell stiffness; similarly, A549 cells pretreated with WRW4 (formyl peptide receptor-like 1 agonist) resulted in a decrease in LL-37–dependent cell stiffening. F, Treatment with ox-ATP (a specific P2X7 purinergic antagonist) and suramin (a nonselective P2X7 purinergic antagonist) had a moderate and no inhibitory effect, respectively. Error bars represent SE (n = 15 cells/condition). *p < 0.05, compared with control group.

FIGURE 1.

Increase in cell stiffness observed ∼30 min after addition of LL-37 to A549 human lung epithelial cells (A) and primary lung epithelial cells (B). C, LL-37–induced increase in A549 cell stiffness is significantly higher compared with the effects of KR-20, WLBU2, or CSA-13 but not RK-30. D, A549 cell stiffening after the addition of P. aeruginosa LPS (1 μg/ml) and P. aeruginosa PAO1 (106 CFU/ml) or P. aeruginosa PAO1 in combination with LL-37. E, Preincubation of LL-37 (2 μM) with LPS inhibits LL-37–induced increase in A549 cell stiffness; similarly, A549 cells pretreated with WRW4 (formyl peptide receptor-like 1 agonist) resulted in a decrease in LL-37–dependent cell stiffening. F, Treatment with ox-ATP (a specific P2X7 purinergic antagonist) and suramin (a nonselective P2X7 purinergic antagonist) had a moderate and no inhibitory effect, respectively. Error bars represent SE (n = 15 cells/condition). *p < 0.05, compared with control group.

Close modal

The ability of LL-37 to induce endothelial cell stiffening in the presence of serum at a concentration that effectively prevents LL-37 bacterial killing (37) suggests that LL-37’s effects might be mediated by activation of plasma membrane receptors (31), rather than less specific interactions that mediate bacteria killing. A role for specific transmembrane proteins in the effect of LL-37 on epithelial cells is also supported by experiments showing inhibition of the stiffness increase in A549 cells subjected to LL-37 activation after treatment with the formyl peptide receptor-like 1 receptor antagonist WRW4 or the P2X7 receptor antagonist ox-ATP (Fig. 1F). The effect of the FMLP1 antagonist was much stronger than the limited effect of ox-ATP and the lack of inhibition by suramin, a weak antagonist of the P2X7 receptor.

Immunofluorescence studies did not reveal a strong expression of hCAP-18/LL-37 in A549 cells (Fig. 2A) or polarized HBECs (data not shown). Positive staining with anti–LL-37 Ab was observed in A549 cells pretreated with 2 μM LL-37 for 30 min. This staining was not present when A549 cells were subjected to permeabilization before Ab addition. This result suggests that most of the LL-37 distributes to plasma membrane compartments, and its direct association with intracellular structures is unlikely. However, we observed an increase in cortical F-actin content in single and confluent A549 cells after the addition of LL-37. This observation provides a mechanism that can explain, at least in part, the LL-37–induced increase in cell stiffness. The intensity of F-actin staining in LL-37–stimulated cells (Fig. 2B) was similar to that observed after N-formylated peptide (formyl-methionyl-leucyl-phenylalanine) activation (data not shown). In ∼10% of a population of A549 cells (Fig. 2B), as well as in primary lung epithelial cells (data not shown), LL-37 induced plasma membrane bleb formation. Remodeling of cytosolic F-actin after LL-37 addition was accompanied by an increase in total F-actin concentration (Fig. 2C). Quantitative densitometry revealed that the phalloidin-stainable F-actin concentration in A549 cells increased ∼50% after the addition of 1–2 μM LL-37.

FIGURE 2.

A, Expression of hCAP-18/LL-37 in A549 cells. A confluent monolayer of A549 cells was stained with anti–hCAP-18/LL-37 Ab without and with membrane permeabilization using Triton X-100 (0.2%). When required, A549 cells were stained with anti–hCAP-18/LL-37 Ab after cell treatment with exogenous LL-37 (2 μM) for 30 min, followed by rinsing two times with PBS. B, F-actin organization in A549 cells after LL-37 treatment in individual cells (upper panels) or confluent cell monolayers (lower panels) visualized with FITC-phalloidin staining. Arrows in the upper right panel indicate A549 cell membrane bleb formation observed in ∼10% of cells subjected to LL-37. Scale bars, 35 μm. In the lower panels, fluorescence intensity distribution of FITC-phalloidin is shown for control and LL-37–treated A549 cell monolayers. This analysis shows an increase in cortical actin in the LL-37–activated monolayer of A549 cells. C, Densitometry analysis of F-actin content in A549 cells subjected to LL-37 or WLBU2 evaluated in cell lysate pellets after 10% SDS electrophoresis and Western blot analysis with anti-human β-actin Ab. The lanes represent: 1, control; 2–5, effect of LL-37 treatment at 0.1, 0.5, 1, and 2 μM, respectively; 6 and 7, treatment with 1 and 2 μM WLBU2. The ratios were obtained by dividing the densitometric value determined for individual spots after treatment by the densitometric value of control.

FIGURE 2.

A, Expression of hCAP-18/LL-37 in A549 cells. A confluent monolayer of A549 cells was stained with anti–hCAP-18/LL-37 Ab without and with membrane permeabilization using Triton X-100 (0.2%). When required, A549 cells were stained with anti–hCAP-18/LL-37 Ab after cell treatment with exogenous LL-37 (2 μM) for 30 min, followed by rinsing two times with PBS. B, F-actin organization in A549 cells after LL-37 treatment in individual cells (upper panels) or confluent cell monolayers (lower panels) visualized with FITC-phalloidin staining. Arrows in the upper right panel indicate A549 cell membrane bleb formation observed in ∼10% of cells subjected to LL-37. Scale bars, 35 μm. In the lower panels, fluorescence intensity distribution of FITC-phalloidin is shown for control and LL-37–treated A549 cell monolayers. This analysis shows an increase in cortical actin in the LL-37–activated monolayer of A549 cells. C, Densitometry analysis of F-actin content in A549 cells subjected to LL-37 or WLBU2 evaluated in cell lysate pellets after 10% SDS electrophoresis and Western blot analysis with anti-human β-actin Ab. The lanes represent: 1, control; 2–5, effect of LL-37 treatment at 0.1, 0.5, 1, and 2 μM, respectively; 6 and 7, treatment with 1 and 2 μM WLBU2. The ratios were obtained by dividing the densitometric value determined for individual spots after treatment by the densitometric value of control.

Close modal

Polarized cell cultures of NHBEs express cilia, as indicated by imaging of fluorescence after staining with an anti-acetylated α-tubulin Ab (Fig. 3A). In agreement with previous studies showing that endothelial cell stiffness can be linked to permeability changes after treatment with barrier-protective agonists (40), we observed a decrease in monolayer permeability after treatment with LL-37 (Fig. 3B) that coincided with an increase in lung epithelial cell stiffness (Fig. 1B). The effect on permeability occurred hours after addition of LL-37, reaching statistical significance within 6 h and increasing at 18 h. In contrast, addition of PAO1 had little or no effect on permeability until 18 h, at which time permeability was increased. There was an ∼10%, but not statistically significant, decrease in NHBE permeability following a 3-h infection with PAO1 bacteria. This observation could be explained by the initial localization of bacteria predominantly in the valleys formed at cell–cell junctions (data not shown), which could inhibit the passage of FITC-dextran. However, this early event of PAO1 bacterial infection is transitional. This strain produces several virulence factors, such as rhamnolipids, exotoxin A, LasA, B proteases, and ExoY, which are able to disrupt intercellular tight junctions (41), causing an increase in permeability in the later phase. Indeed, at 18 h we observed a significant increase in permeability of NHBE monolayers subjected to PAO1 infection compared with a noninfected monolayer. At the 18-h data point, we also observed a significantly lower fluorescence of FITC-dextran in the lower chamber for LL-37–treated wells, indicating that treatment with LL-37 results in persistent inhibition of polarized NHBE permeability (Fig. 3B).

FIGURE 3.

A, Fully developed polarized culture of NHBEs. Red staining of α-tubulin indicates the presence of cilia. Cortical actin shown by green staining with fluorescent phalloidin. Scale bar, 35 μm. B, Permeability of polarized NHBE monolayer grown for 4–5 wk on 0.4-μm pore-sized inserts was evaluated 3–18 h after LL-37 or P. aeruginosa PAO1 by movement of FITC-dextran (1 mg/ml) that was added to the upper chamber (apical interface), resulting in fluorescence in media taken from the lower chamber. Error bars represent SD from four or five measurements. *p < 0.05, compared with control group.

FIGURE 3.

A, Fully developed polarized culture of NHBEs. Red staining of α-tubulin indicates the presence of cilia. Cortical actin shown by green staining with fluorescent phalloidin. Scale bar, 35 μm. B, Permeability of polarized NHBE monolayer grown for 4–5 wk on 0.4-μm pore-sized inserts was evaluated 3–18 h after LL-37 or P. aeruginosa PAO1 by movement of FITC-dextran (1 mg/ml) that was added to the upper chamber (apical interface), resulting in fluorescence in media taken from the lower chamber. Error bars represent SD from four or five measurements. *p < 0.05, compared with control group.

Close modal

With the use of the gentamicin-protection assay, we determined the number of internalized bacteria following infection of A549 cells with P. aeruginosa PAO1 and three nonmucoid Pseudomonas clinical isolates obtained from CF sputum. Because reduced internalization of PAO1 by A549 in the presence of LL-37 might be due to bactericidal effects of LL-37 prior to bacterial entry into the A549 cell, internalization of PAO1 was quantified in an experimental setting in which cells were treated with LL-37 for 30 min and then washed before bacteria addition, as well as when LL-37 was kept in the medium during the 3-h period of infection. The data in Fig. 4 show that LL-37, at concentrations up to 10 μM, had no killing activity in DMEM against PAO1 bacteria or three clinical isolates of P. aeruginosa (data not shown) diluted in DMEM. Therefore, reduced PAO1 outgrowth after A549 cell lysis in this assay reflected reduced prior entry of the bacteria into the A549 cells.

FIGURE 4.

Bactericidal activity of LL-37 and gentamicin (GEN) against P. aeruginosa PAO1 evaluated in DMEM. Error bars represent SD from four measurements. *p < 0.05, compared with control group.

FIGURE 4.

Bactericidal activity of LL-37 and gentamicin (GEN) against P. aeruginosa PAO1 evaluated in DMEM. Error bars represent SD from four measurements. *p < 0.05, compared with control group.

Close modal

At 3 h postinfection, PAO1 internalization by A549 cells was reduced upon pretreatment with LL-37 compared with infected cells without LL-37 treatment (Fig. 5A). Fig. 5B shows that 1 μM LL-37 significantly decreased the uptake of these clinical isolates of Pseudomonas by A549 cells and primary lung epithelial cells, but had no effect on bacteria outgrowth in medium alone (Fig. 4). There was a quantitative difference in susceptibility to Pseudomonas invasion between A549 cells and primary lung epithelial cells, likely resulting from differences in experimental settings. To observe invasion of polarized primary lung epithelial cells, protected by a mucin layer covering their apical surface and likely containing natural antibacterial agents expressed by fully differentiated NHBEs, the number of administered bacteria required was higher (∼107 CFU) than the concentration needed to infect nonpolarized A549 cultures.

FIGURE 5.

A, P. aeruginosa PAO1 uptake by human lung epithelial cells 3 h after bacteria addition (∼106 CFU) to A549 cell confluent monolayer. LL-37 treatment was performed in two settings: for 30 min followed by washing out of peptide before addition of bacterial solution (black columns) and for 30 min before bacteria addition without washing out LL-37 (gray columns). Uptake of three clinical strains of P. aeruginosa by polarized culture of A549 cells (B) and NHBEs (C). Cells were incubated with ∼107 CFU of clinical strains of P. aeruginosa isolated from CF sputum without and with 1 μM LL-37. Error bars represent SD from four measurements (A) or one experiment with three replicates (B, C). *p < 0.05, compared with control group.

FIGURE 5.

A, P. aeruginosa PAO1 uptake by human lung epithelial cells 3 h after bacteria addition (∼106 CFU) to A549 cell confluent monolayer. LL-37 treatment was performed in two settings: for 30 min followed by washing out of peptide before addition of bacterial solution (black columns) and for 30 min before bacteria addition without washing out LL-37 (gray columns). Uptake of three clinical strains of P. aeruginosa by polarized culture of A549 cells (B) and NHBEs (C). Cells were incubated with ∼107 CFU of clinical strains of P. aeruginosa isolated from CF sputum without and with 1 μM LL-37. Error bars represent SD from four measurements (A) or one experiment with three replicates (B, C). *p < 0.05, compared with control group.

Close modal

We also examined the effect of bacterial internalization on host cell viability by measurement of LDH concentration in the tissue culture medium. This analysis revealed no change between the LDH levels in medium collected from infected and noninfected cells 3 h postinfection (data not shown). This result is in agreement with a previous report showing a lack of PAO1 toxicity following infection of CFBE41o cells up to 24 h postinfection (20).

Numerous studies concluded that human cathelicidin LL-37 peptide functions as an important mediator of innate immunity. In addition to its antibacterial activity, LL-37 possesses several functions that are related to host defense, such as chemotactic, endotoxin-neutralizing, angiogenic, and wound-healing activities (3, 42, 43). This study showed that LL-37’s ability to induce an increase in lung epithelial F-actin content and cellular stiffness provides a possible explanation for its role in preventing epithelial invasion by pathogens and adding new insight into its pleiotropic nature. Together with its potential to preferentially promote apoptosis in the infected airway epithelium (44), LL-37’s ability to increase epithelial stiffness and decrease permeability in response to bacterial infection may serve as a first line of defense to prevent bacterial invasion. The effect of LL-37 on epithelial cells, together with its ability to neutralize LPS, might also provide an explanation for the finding that lung injury in guinea pigs subjected to i.v. endotoxin was significantly attenuated by treatment with a 32-aa C-terminal fragment of rabbit CAP18 (45)

Previous studies showed that P. aeruginosa strains, including PAO1, can survive in the cytoplasm of epithelial cells and suggest different mechanisms leading to bacterial uptake (20, 30, 46). At least one pathway of bacterial internalization is an actin-dependent endocytic process, as suggested by its inhibition by cytochalasin D (20). However, it is not clear how the different mechanisms resulting in Pseudomonas internalization are switched on, how such a decision is established at the level of bacteria and host cells, and which structures govern this process. It is plausible that modulation of cellular actin dynamics, either by an increase or decrease in F-actin content, can inhibit internalization of P. aeruginosa by the epithelium. Our findings support a model in which P. aeruginosa internalization can infect epithelial cells through more than one pathway (47), including targeting molecules associated with lipid rafts (48, 49), such as Lyn (50) and caveolin-2 (51). LL-37’s ability to interact with lipid rafts is suggested by its high surface activity (52), the caveolae-independent membrane raft-dependent endocytosis of an LL-37/DNA plasmid complex (53), and LL-37–mediated/raft-dependent LPS internalization (54). Because LL-37 activates multiple plasma receptors, and the cellular mechanical response to agonists depends on the receptor engaged (55), it is also possible that the LL-37–mediated increase in F-actin concentration results in the formation of distinct cytoskeletal networks with mechanical properties that affect bacterial invasion.

LL-37 appears to have a general, but integral, effect on the strengthening of epithelial barriers to invading pathogens in various compartments of the human body that is separate from, but complementary to, its bactericidal activity. It could be inferred from our results that during an acute or chronic bacterial infection of the respiratory tract, LL-37 functions to increase the stiffness of the epithelium, which correlates with and might be required to decrease epithelial permeability and reduce bacterial entry. A recent study by Wagh et al. (56) showed a complex distribution of cell stiffness at the site of an epithelial wound, with a decreased stiffness at the very edge and a significant increase observed 10–20 μm away from the leading edge compared with cells >2.75 mm away from the wound. It is tempting to hypothesize that LL-37–induced changes in actin assembly and cell stiffness play a role in its reported ability to accelerate epithelial wound healing (10, 57) at the site of infections.

Exposure of lung epithelial cells to PAO1 bacteria and LPS also resulted in a significant increase in their elastic modulus. This effect could indicate that the natural response of lung epithelium is to increase its stiffness in an attempt to prevent bacterial entry during infection, and the increased presence of LL-37 is able to pre-emptively induce and bolster this stiffening response. Alternately, LL-37 is able to bind to LPS, which could also result in a reduction in proinflammatory stimuli (39). However, this interaction might also result in a gradual functional sequestration of LL-37 during the course of the infection, depending on the relative amounts of LPS and LL-37. A better understanding of the complex interactions among LL-37, lung epithelial cells, and pathogen bacteria, such as P. aeruginosa, and its products, such as LPS, might enable more effective therapeutic strategies during respiratory tract infections.

We thank Melissa Mendez, Qi Wen, and Marianne Ferrin for assistance and patients of the Adult Cystic Fibrosis Center of the University of Pennsylvania for providing sputum samples.

This work was supported by National Institutes of Health Grants HL67286 and GM83187.

Abbreviations used in this article:

CAP

cationic antibacterial peptide

CF

cystic fibrosis

h

human

LDH

lactate dehydrogenase

NHBE

normal human bronchial epithelial cell

ox-ATP

oxidized ATP

PIA

Pseudomonas isolation agar

S1P

sphingosine 1-phosphate

TSB

tryptic soy broth.

1
Yeaman
M. R.
,
Yount
N. Y.
.
2003
.
Mechanisms of antimicrobial peptide action and resistance.
Pharmacol. Rev.
55
:
27
55
.
2
Jenssen
H.
,
Hamill
P.
,
Hancock
R. E.
.
2006
.
Peptide antimicrobial agents.
Clin. Microbiol. Rev.
19
:
491
511
.
3
Bucki
R.
,
Leszczyńska
K.
,
Namiot
A.
,
Sokołowski
W.
.
2010
.
Cathelicidin LL-37: a multitask antimicrobial peptide.
Arch. Immunol. Ther. Exp. (Warsz.)
58
:
15
25
.
4
Gudmundsson
G. H.
,
Agerberth
B.
,
Odeberg
J.
,
Bergman
T.
,
Olsson
B.
,
Salcedo
R.
.
1996
.
The human gene FALL39 and processing of the cathelin precursor to the antibacterial peptide LL-37 in granulocytes.
Eur. J. Biochem.
238
:
325
332
.
5
Pütsep
K.
,
Carlsson
G.
,
Boman
H. G.
,
Andersson
M.
.
2002
.
Deficiency of antibacterial peptides in patients with morbus Kostmann: an observation study.
Lancet
360
:
1144
1149
.
6
Nizet
V.
,
Ohtake
T.
,
Lauth
X.
,
Trowbridge
J.
,
Rudisill
J.
,
Dorschner
R. A.
,
Pestonjamasp
V.
,
Piraino
J.
,
Huttner
K.
,
Gallo
R. L.
.
2001
.
Innate antimicrobial peptide protects the skin from invasive bacterial infection.
Nature
414
:
454
457
.
7
Bals
R.
,
Weiner
D. J.
,
Meegalla
R. L.
,
Wilson
J. M.
.
1999
.
Transfer of a cathelicidin peptide antibiotic gene restores bacterial killing in a cystic fibrosis xenograft model.
J. Clin. Invest.
103
:
1113
1117
.
8
De Yang
Q.
,
Chen
A. P.
,
Schmidt
G. M.
,
Anderson
J. M.
,
Wang
J.
,
Wooters
J. J.
,
Oppenheim
,
Chertov
O.
.
2000
.
LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cells.
J. Exp. Med.
192
:
1069
1074
.
9
Tjabringa
G. S.
,
Aarbiou
J.
,
Ninaber
D. K.
,
Drijfhout
J. W.
,
Sørensen
O. E.
,
Borregaard
N.
,
Rabe
K. F.
,
Hiemstra
P. S.
.
2003
.
The antimicrobial peptide LL-37 activates innate immunity at the airway epithelial surface by transactivation of the epidermal growth factor receptor.
J. Immunol.
171
:
6690
6696
.
10
Shaykhiev
R.
,
Beisswenger
C.
,
Kändler
K.
,
Senske
J.
,
Püchner
A.
,
Damm
T.
,
Behr
J.
,
Bals
R.
.
2005
.
Human endogenous antibiotic LL-37 stimulates airway epithelial cell proliferation and wound closure.
Am. J. Physiol. Lung Cell. Mol. Physiol.
289
:
L842
L848
.
11
Elssner
A.
,
Duncan
M.
,
Gavrilin
M.
,
Wewers
M. D.
.
2004
.
A novel P2X7 receptor activator, the human cathelicidin-derived peptide LL37, induces IL-1 beta processing and release.
J. Immunol.
172
:
4987
4994
.
12
Bowdish
D. M.
,
Davidson
D. J.
,
Lau
Y. E.
,
Lee
K.
,
Scott
M. G.
,
Hancock
R. E.
.
2005
.
Impact of LL-37 on anti-infective immunity.
J. Leukoc. Biol.
77
:
451
459
.
13
Ciornei
C. D.
,
Sigurdardóttir
T.
,
Schmidtchen
A.
,
Bodelsson
M.
.
2005
.
Antimicrobial and chemoattractant activity, lipopolysaccharide neutralization, cytotoxicity, and inhibition by serum of analogs of human cathelicidin LL-37.
Antimicrob. Agents Chemother.
49
:
2845
2850
.
14
Pier
G. B.
,
Grout
M.
,
Zaidi
T. S.
,
Olsen
J. C.
,
Johnson
L. G.
,
Yankaskas
J. R.
,
Goldberg
J. B.
.
1996
.
Role of mutant CFTR in hypersusceptibility of cystic fibrosis patients to lung infections.
Science
271
:
64
67
.
15
Lee
A.
,
Chow
D.
,
Haus
B.
,
Tseng
W.
,
Evans
D.
,
Fleiszig
S.
,
Chandy
G.
,
Machen
T.
.
1999
.
Airway epithelial tight junctions and binding and cytotoxicity of Pseudomonas aeruginosa.
Am. J. Physiol.
277
:
L204
L217
.
16
Plotkowski
M. C.
,
de Bentzmann
S.
,
Pereira
S. H.
,
Zahm
J. M.
,
Bajolet-Laudinat
O.
,
Roger
P.
,
Puchelle
E.
.
1999
.
Pseudomonas aeruginosa internalization by human epithelial respiratory cells depends on cell differentiation, polarity, and junctional complex integrity.
Am. J. Respir. Cell Mol. Biol.
20
:
880
890
.
17
Chi
E.
,
Mehl
T.
,
Nunn
D.
,
Lory
S.
.
1991
.
Interaction of Pseudomonas aeruginosa with A549 pneumocyte cells.
Infect. Immun.
59
:
822
828
.
18
Fleiszig
S. M.
,
Zaidi
T. S.
,
Preston
M. J.
,
Grout
M.
,
Evans
D. J.
,
Pier
G. B.
.
1996
.
Relationship between cytotoxicity and corneal epithelial cell invasion by clinical isolates of Pseudomonas aeruginosa.
Infect. Immun.
64
:
2288
2294
.
19
Cannon
C. L.
,
Kowalski
M. P.
,
Stopak
K. S.
,
Pier
G. B.
.
2003
.
Pseudomonas aeruginosa-induced apoptosis is defective in respiratory epithelial cells expressing mutant cystic fibrosis transmembrane conductance regulator.
Am. J. Respir. Cell Mol. Biol.
29
:
188
197
.
20
Darling
K. E.
,
Dewar
A.
,
Evans
T. J.
.
2004
.
Role of the cystic fibrosis transmembrane conductance regulator in internalization of Pseudomonas aeruginosa by polarized respiratory epithelial cells.
Cell. Microbiol.
6
:
521
533
.
21
Lee
H. S.
,
Gu
F.
,
Ching
S. M.
,
Lam
Y.
,
Chua
K. L.
.
2010
.
CdpA is a Burkholderia pseudomallei cyclic di-GMP phosphodiesterase involved in autoaggregation, flagellum synthesis, motility, biofilm formation, cell invasion, and cytotoxicity.
Infect. Immun.
78
:
1832
1840
.
22
Grassmé
H.
,
Kirschnek
S.
,
Riethmueller
J.
,
Riehle
A.
,
von Kürthy
G.
,
Lang
F.
,
Weller
M.
,
Gulbins
E.
.
2000
.
CD95/CD95 ligand interactions on epithelial cells in host defense to Pseudomonas aeruginosa.
Science
290
:
527
530
.
23
Ha
U.
,
Jin
S.
.
2001
.
Growth phase-dependent invasion of Pseudomonas aeruginosa and its survival within HeLa cells.
Infect. Immun.
69
:
4398
4406
.
24
Evans
D. J.
,
Frank
D. W.
,
Finck-Barbançon
V.
,
Wu
C.
,
Fleiszig
S. M.
.
1998
.
Pseudomonas aeruginosa invasion and cytotoxicity are independent events, both of which involve protein tyrosine kinase activity.
Infect. Immun.
66
:
1453
1459
.
25
Massengale
A. R.
,
Quinn
F. J.
,
Williams
A.
,
Gallagher
S.
,
Aronoff
S. C.
.
2000
.
The effect of alginate on the invasion of cystic fibrosis respiratory epithelial cells by clinical isolates of Pseudomonas aeruginosa.
Exp. Lung Res.
26
:
163
178
.
26
Esen
M.
,
Grassmé
H.
,
Riethmüller
J.
,
Riehle
A.
,
Fassbender
K.
,
Gulbins
E.
.
2001
.
Invasion of human epithelial cells by Pseudomonas aeruginosa involves src-like tyrosine kinases p60Src and p59Fyn.
Infect. Immun.
69
:
281
287
.
27
Ding
B.
,
Taotofa
U.
,
Orsak
T.
,
Chadwell
M.
,
Savage
P. B.
.
2004
.
Synthesis and characterization of peptide-cationic steroid antibiotic conjugates.
Org. Lett.
6
:
3433
3436
.
28
Murakami
M.
,
Lopez-Garcia
B.
,
Braff
M.
,
Dorschner
R. A.
,
Gallo
R. L.
.
2004
.
Postsecretory processing generates multiple cathelicidins for enhanced topical antimicrobial defense.
J. Immunol.
172
:
3070
3077
.
29
Isberg
R. R.
,
Falkow
S.
.
1985
.
A single genetic locus encoded by Yersinia pseudotuberculosis permits invasion of cultured animal cells by Escherichia coli K-12.
Nature
317
:
262
264
.
30
Burns
J. L.
,
Jonas
M.
,
Chi
E. Y.
,
Clark
D. K.
,
Berger
A.
,
Griffith
A.
.
1996
.
Invasion of respiratory epithelial cells by Burkholderia (Pseudomonas) cepacia.
Infect. Immun.
64
:
4054
4059
.
31
Byfield
F. J.
,
Wen
Q.
,
Leszczynska
K.
,
Kulakowska
A.
,
Namiot
Z.
,
Janmey
P. A.
,
Bucki
R.
.
2011
.
Cathelicidin LL-37 peptide regulates endothelial cell stiffness and endothelial barrier permeability.
Am. J. Physiol. Cell Physiol.
300
:
C105
C112
.
32
Deslouches
B.
,
Islam
K.
,
Craigo
J. K.
,
Paranjape
S. M.
,
Montelaro
R. C.
,
Mietzner
T. A.
.
2005
.
Activity of the de novo engineered antimicrobial peptide WLBU2 against Pseudomonas aeruginosa in human serum and whole blood: implications for systemic applications.
Antimicrob. Agents Chemother.
49
:
3208
3216
.
33
Bucki
R.
,
Namiot
D. B.
,
Namiot
Z.
,
Savage
P. B.
,
Janmey
P. A.
.
2008
.
Salivary mucins inhibit antibacterial activity of the cathelicidin-derived LL-37 peptide but not the cationic steroid CSA-13.
J. Antimicrob. Chemother.
62
:
329
335
.
34
Arce
F. T.
,
Whitlock
J. L.
,
Birukova
A. A.
,
Birukov
K. G.
,
Arnsdorf
M. F.
,
Lal
R.
,
Garcia
J. G.
,
Dudek
S. M.
.
2008
.
Regulation of the micromechanical properties of pulmonary endothelium by S1P and thrombin: role of cortactin.
Biophys. J.
95
:
886
894
.
35
Turner
J.
,
Cho
Y.
,
Dinh
N. N.
,
Waring
A. J.
,
Lehrer
R. I.
.
1998
.
Activities of LL-37, a cathelin-associated antimicrobial peptide of human neutrophils.
Antimicrob. Agents Chemother.
42
:
2206
2214
.
36
Zughaier
S. M.
,
Shafer
W. M.
,
Stephens
D. S.
.
2005
.
Antimicrobial peptides and endotoxin inhibit cytokine and nitric oxide release but amplify respiratory burst response in human and murine macrophages.
Cell. Microbiol.
7
:
1251
1262
.
37
Bucki
R.
,
Janmey
P. A.
.
2006
.
Interaction of the gelsolin-derived antibacterial PBP 10 peptide with lipid bilayers and cell membranes.
Antimicrob. Agents Chemother.
50
:
2932
2940
.
38
Nell
M. J.
,
Tjabringa
G. S.
,
Wafelman
A. R.
,
Verrijk
R.
,
Hiemstra
P. S.
,
Drijfhout
J. W.
,
Grote
J. J.
.
2006
.
Development of novel LL-37 derived antimicrobial peptides with LPS and LTA neutralizing and antimicrobial activities for therapeutic application.
Peptides
27
:
649
660
.
39
Rosenfeld
Y.
,
Papo
N.
,
Shai
Y.
.
2006
.
Endotoxin (lipopolysaccharide) neutralization by innate immunity host-defense peptides. Peptide properties and plausible modes of action.
J. Biol. Chem.
281
:
1636
1643
.
40
Birukova
A. A.
,
Arce
F. T.
,
Moldobaeva
N.
,
Dudek
S. M.
,
Garcia
J. G.
,
Lal
R.
,
Birukov
K. G.
.
2009
.
Endothelial permeability is controlled by spatially defined cytoskeletal mechanics: atomic force microscopy force mapping of pulmonary endothelial monolayer.
Nanomedicine
5
:
30
41
.
41
Lau
G. W.
,
Hassett
D. J.
,
Britigan
B. E.
.
2005
.
Modulation of lung epithelial functions by Pseudomonas aeruginosa.
Trends Microbiol.
13
:
389
397
.
42
Kai-Larsen
Y.
,
Agerberth
B.
.
2008
.
The role of the multifunctional peptide LL-37 in host defense.
Front. Biosci.
13
:
3760
3767
.
43
Nijnik
A.
,
Hancock
R. E.
.
2009
.
The roles of cathelicidin LL-37 in immune defences and novel clinical applications.
Curr. Opin. Hematol.
16
:
41
47
.
44
Barlow
P. G.
,
Beaumont
P. E.
,
Cosseau
C.
,
Mackellar
A.
,
Wilkinson
T. S.
,
Hancock
R. E.
,
Haslett
C.
,
Govan
J. R.
,
Simpson
A. J.
,
Davidson
D. J.
.
2010
.
The human cathelicidin LL-37 preferentially promotes apoptosis of infected airway epithelium.
Am. J. Respir. Cell Mol. Biol.
43
:
692
702
.
45
Tasaka
S.
,
Ishizaka
A.
,
Urano
T.
,
Sayama
K.
,
Sakamaki
F.
,
Nakamura
H.
,
Terashima
T.
,
Waki
Y.
,
Soejima
K.
,
Nakamura
M.
, et al
.
1996
.
A derivative of cationic antimicrobial protein attenuates lung injury by suppressing cell adhesion.
Am. J. Respir. Cell Mol. Biol.
15
:
738
744
.
46
Fleiszig
S. M.
,
Zaidi
T. S.
,
Pier
G. B.
.
1995
.
Pseudomonas aeruginosa invasion of and multiplication within corneal epithelial cells in vitro.
Infect. Immun.
63
:
4072
4077
.
47
Cowell
B. A.
,
Evans
D. J.
,
Fleiszig
S. M.
.
2005
.
Actin cytoskeleton disruption by ExoY and its effects on Pseudomonas aeruginosa invasion.
FEMS Microbiol. Lett.
250
:
71
76
.
48
Abraham
S. N.
,
Duncan
M. J.
,
Li
G.
,
Zaas
D.
.
2005
.
Bacterial penetration of the mucosal barrier by targeting lipid rafts.
J. Investig. Med.
53
:
318
321
.
49
Yamamoto
N.
,
Yamamoto
N.
,
Jester
J. V.
,
Petroll
W. M.
,
Cavanagh
H. D.
.
2006
.
Prolonged hypoxia induces lipid raft formation and increases Pseudomonas internalization in vivo after contact lens wear and lid closure.
Eye Contact Lens
32
:
114
120
.
50
Kannan
S.
,
Audet
A.
,
Knittel
J.
,
Mullegama
S.
,
Gao
G. F.
,
Wu
M.
.
2006
.
Src kinase Lyn is crucial for Pseudomonas aeruginosa internalization into lung cells.
Eur. J. Immunol.
36
:
1739
1752
.
51
Zaas
D. W.
,
Swan
Z. D.
,
Brown
B. J.
,
Li
G.
,
Randell
S. H.
,
Degan
S.
,
Sunday
M. E.
,
Wright
J. R.
,
Abraham
S. N.
.
2009
.
Counteracting signaling activities in lipid rafts associated with the invasion of lung epithelial cells by Pseudomonas aeruginosa.
J. Biol. Chem.
284
:
9955
9964
.
52
Bucki
R.
,
Pastore
J. J.
,
Randhawa
P.
,
Vegners
R.
,
Weiner
D. J.
,
Janmey
P. A.
.
2004
.
Antibacterial activities of rhodamine B-conjugated gelsolin-derived peptides compared to those of the antimicrobial peptides cathelicidin LL37, magainin II, and melittin.
Antimicrob. Agents Chemother.
48
:
1526
1533
.
53
Sandgren
S.
,
Wittrup
A.
,
Cheng
F.
,
Jönsson
M.
,
Eklund
E.
,
Busch
S.
,
Belting
M.
.
2004
.
The human antimicrobial peptide LL-37 transfers extracellular DNA plasmid to the nuclear compartment of mammalian cells via lipid rafts and proteoglycan-dependent endocytosis.
J. Biol. Chem.
279
:
17951
17956
.
54
Shaykhiev
R.
,
Sierigk
J.
,
Herr
C.
,
Krasteva
G.
,
Kummer
W.
,
Bals
R.
.
2010
.
The antimicrobial peptide cathelicidin enhances activation of lung epithelial cells by LPS.
FASEB J.
24
:
4756
4766
.
55
Huang
H.
,
Sylvan
J.
,
Jonas
M.
,
Barresi
R.
,
So
P. T.
,
Campbell
K. P.
,
Lee
R. T.
.
2005
.
Cell stiffness and receptors: evidence for cytoskeletal subnetworks.
Am. J. Physiol. Cell Physiol.
288
:
C72
C80
.
56
Wagh
A. A.
,
Roan
E.
,
Chapman
K. E.
,
Desai
L. P.
,
Rendon
D. A.
,
Eckstein
E. C.
,
Waters
C. M.
.
2008
.
Localized elasticity measured in epithelial cells migrating at a wound edge using atomic force microscopy.
Am. J. Physiol. Lung Cell. Mol. Physiol.
295
:
L54
L60
.
57
Heilborn
J. D.
,
Nilsson
M. F.
,
Kratz
G.
,
Weber
G.
,
Sørensen
O.
,
Borregaard
N.
,
Ståhle-Bäckdahl
M.
.
2003
.
The cathelicidin anti-microbial peptide LL-37 is involved in re-epithelialization of human skin wounds and is lacking in chronic ulcer epithelium.
J. Invest. Dermatol.
120
:
379
389
.

The authors have no financial conflicts of interest.